PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013816.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 402aa    MW: 43333.1 Da    PI: 7.9928
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013816.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.57.8e-10259317563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  Do013816.1 259 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLATQN 317
                 999*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16255319IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691257320IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-10259316No hitNo description
PfamPF001703.3E-9259317IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10259310No hitNo description
CDDcd147032.96E-21260311No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MNTANGHGLM HHHHHHVQAS MPPPPQHQKQ QRAGLPPTPP PAGPGSHSHS LHHGDACMDD  60
SSAAARAQAQ AQGGLPPRKQ AHRRSRSDVA FGYFQPLPPP SLKTEAGGWG GLPGGGGAAA  120
GDDLFNAYMS MEGMDGLNNS DGDSRGSSGM RTNGGADSSE NESEDYGGGG GGADSQFLLW  180
GGDAGKKKRN AAGEPAPPPP ARHARSLSMD SLMGKLSFSA NGEPGKFSLE FGGGEFTPAE  240
MKRIMADEKL AEMALADPKR VKRVLANRQS AARSKERRMR YIAELEQKVQ ILQTEATTLS  300
AQLTLLQRDS AGLATQNNEL KFRLQAMEQQ AQLRDALNEA LTTEVQRLKL GETSSSSNMS  360
QQMQLRSQNQ MMEMHKQQGE QIPFYQLEQR EQNGAPRNHD PK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.10.0PREDICTED: transcription factor RF2b-like
TrEMBLK4AKY80.0K4AKY8_SETIT; Uncharacterized protein
STRINGSi039566m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.36e-55bZIP family protein